TB-500 (Thymosin Beta-4 Fragment): Actin Regulation and Published Research
Discovery and Scientific Background
Thymosin Beta-4 (Tβ4) was originally isolated from calf thymus tissue in 1981 by Allan Goldstein and colleagues at George Washington University as part of a systematic effort to characterize thymic peptide hormones. TB-500 refers to a synthetic peptide corresponding to the active region of the full 43-amino acid Tβ4 protein. Thymosin Beta-4 is one of the most abundant intracellular peptides, present in virtually all nucleated cells except erythrocytes.
Chemical Structure
The full Thymosin Beta-4 protein has a molecular weight of approximately 4,921 Da and the sequence SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES. The central active domain contains the actin-binding motif LKKTETQ (residues 17-23), which is responsible for the peptide's interaction with G-actin monomers. TB-500 is supplied as a lyophilized powder and is soluble in aqueous buffers.
Mechanism of Action
Actin Sequestration and Cytoskeletal Dynamics
The primary documented molecular function of Tβ4 is sequestration of monomeric G-actin, preventing its polymerization into F-actin filaments. This actin-buffering activity plays a role in cytoskeletal remodeling, which is fundamental to cell motility, morphogenesis, and organelle transport. The LKKTETQ motif binds the cleft between actin subdomains 1 and 3.
Cell Migration Studies
In vitro scratch wound assays and Boyden chamber migration experiments have demonstrated that Tβ4 promotes migration of endothelial cells, keratinocytes, and corneal epithelial cells. This migration activity has been linked to both the actin-sequestration function and independent signaling through Akt/protein kinase B activation.
Reference: Malinda KM et al. Thymosin beta4 accelerates wound healing. J Invest Dermatol. 1999;113(3):364-8.
MMP and Extracellular Matrix Interactions
Research has shown that Tβ4 upregulates matrix metalloproteinase expression (particularly MMP-2) in cell models, suggesting a role in extracellular matrix remodeling. Additional studies have examined its effects on laminin-5 (laminin-332) production.
Key Published Studies
- Philp D et al. (2003) — Demonstrated Tβ4 promotion of angiogenesis in matrigel plug assays.
- Bock-Marquette I et al. (2004) — Published in Nature, examined Tβ4 in murine cardiac models following coronary artery ligation.
- Smart N et al. (2010) — Investigated Tβ4 and epicardial progenitor cell activation in murine models.
Future Research Directions
Active areas of investigation include the peptide's role in epigenetic regulation (Tβ4 has been shown to interact with chromatin remodeling complexes), its function in stem cell biology and progenitor cell mobilization, and development of structure-activity relationship studies to identify minimal active fragments. The corneal epithelial research applications have also generated considerable interest.
Crush Research supplies TB-500 in 10mg vials and as part of the Wolverine Blend (BPC-157/TB-500). All lots verified by independent HPLC and MS testing with published Certificates of Analysis.
All products are intended for in vitro and laboratory research use only. Not for human or veterinary use.